General Information

  • ID:  hor005246
  • Uniprot ID:  P0C228
  • Protein name:  Big gastrin
  • Gene name:  GAST
  • Organism:  Macropus giganteus (Eastern gray kangaroo)
  • Family:  Gastrin/cholecystokinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Macropus (genus), Macropodidae (family), Diprotodontia (order), Metatheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QLHPQDLPHLMTDLSKKKGPWQEEDAAYGWMDF
  • Length:  33
  • Propeptide:  QLHPQDLPHLMTDLSKKKGPWQEEDAAYGWMDF
  • Signal peptide:  NA
  • Modification:  T1 Pyrrolidone carboxylic acid;T28 Sulfotyrosine;T33 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P0C228-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P0C228-F1.pdbhor005246_AF2.pdbhor005246_ESM.pdb

Physical Information

Mass: 448438 Formula: C177H259N45O52S2
Absent amino acids: CINRV Common amino acids: DL
pI: 4.7 Basic residues: 5
Polar residues: 5 Hydrophobic residues: 9
Hydrophobicity: -104.24 Boman Index: -5968
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 53.33
Instability Index: 4962.42 Extinction Coefficient cystines: 12490
Absorbance 280nm: 390.31

Literature

  • PubMed ID:  8134294
  • Title:  Gastrin and cholecystokinin in the Eastern Grey kangaroo, Macropus giganteus giganteus.